Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDM7 Rabbit Polyclonal Antibody (FITC)

PRDM7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PFM4, ZNF910

UniProt

Q9NQW5

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PRDM7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FIDSCAAHGPPTFVKDSAVDKGHPNRSALSLPPGLRIGPSGIPQAGLGVW

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-mmu-mir-7578 Virus
mm1060 250 µL

AdmiRa-mmu-mir-7578 Virus

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to RAD54 Like Protein 2 (RAD54L2)
MBS2085264-01 0.1 mL

PE-Linked Polyclonal Antibody to RAD54 Like Protein 2 (RAD54L2)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to RAD54 Like Protein 2 (RAD54L2)
MBS2085264-02 0.2 mL

PE-Linked Polyclonal Antibody to RAD54 Like Protein 2 (RAD54L2)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to RAD54 Like Protein 2 (RAD54L2)
MBS2085264-03 0.5 mL

PE-Linked Polyclonal Antibody to RAD54 Like Protein 2 (RAD54L2)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to RAD54 Like Protein 2 (RAD54L2)
MBS2085264-04 1 mL

PE-Linked Polyclonal Antibody to RAD54 Like Protein 2 (RAD54L2)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to RAD54 Like Protein 2 (RAD54L2)
MBS2085264-05 5 mL

PE-Linked Polyclonal Antibody to RAD54 Like Protein 2 (RAD54L2)

Sign In for Pricing
View Details