Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ASCL3 Rabbit Polyclonal Antibody (Biotin)

ASCL3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SGN1, HASH3, bHLHa42

UniProt

Q9NQ33

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ASCL3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKAETKNNPGKVSSMIATT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065697

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

2610018G03Rik CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
10458154 3x 1.0 µg DNA

2610018G03Rik CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal CD45 Antibody (998209) [PE/Cy7]
FAB14301PECY7 0.1 mL

Mouse Monoclonal CD45 Antibody (998209) [PE/Cy7]

Sign In for Pricing
View Details
Human ATP6V0E2 siRNA
abx900545-01 15 nmol

Human ATP6V0E2 siRNA

Sign In for Pricing
View Details
Human ATP6V0E2 siRNA
abx900545-02 30 nmol

Human ATP6V0E2 siRNA

Sign In for Pricing
View Details
DDR1, NT (Epithelial Discoidin Domain-containing Receptor 1, Epithelial Discoidin Domain Receptor 1, Tyrosine Kinase DDR, Discoidin Receptor Tyrosine Kinase, Tyrosine-protein Kinase CAK, Cell Adhesion Kinase, TRK E, Protein-tyrosine Kinase 3A, Protein-tyrosine Kinase RTK 6, HGK2, CD167 Antigen-like Family Member A, Mammary Carcinoma Kinase 10, MCK-10, CD167a, DDR1, CAK, EDDR1, NEP, NTRK4, PTK3A, RTK6, TRKE) (MaxLight 490) discontinued
D1649-01E-ML490 100 µL

DDR1, NT (Epithelial Discoidin Domain-containing Receptor 1, Epithelial Discoidin Domain Receptor 1, Tyrosine Kinase DDR, Discoidin Receptor Tyrosine Kinase, Tyrosine-protein Kinase CAK, Cell Adhesion Kinase, TRK E, Protein-tyrosine Kinase 3A, Protein-tyrosine Kinase RTK 6, HGK2, CD167 Antigen-like Family Member A, Mammary Carcinoma Kinase 10, MCK-10, CD167a, DDR1, CAK, EDDR1, NEP, NTRK4, PTK3A, RTK6, TRKE) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Human HNRNPF Pre-designed siRNA Set B
SI007164B 1 Each

Human HNRNPF Pre-designed siRNA Set B

Sign In for Pricing
View Details