Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBX4 Rabbit Polyclonal Antibody (Biotin)

CBX4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PC2, NBP16

UniProt

O00257

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CBX4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KWRGWSPKYNTWEPEENILDPRLLIAFQNRERQEQLMGYRKRGPKPKPLV

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPAP3, ID (RPAP3, RNA polymerase II-associated protein 3) (MaxLight 650) discontinued
041179-ML650 100 µL

RPAP3, ID (RPAP3, RNA polymerase II-associated protein 3) (MaxLight 650) discontinued

Sign In for Pricing
View Details
TFAP2D, CT (TFAP2D, TFAP2BL1, Transcription factor AP-2-delta, Activating enhancer-binding protein 2-delta, Transcription factor AP-2-beta-like 1) (AP)
MBS6354964-01 0.2 mL

TFAP2D, CT (TFAP2D, TFAP2BL1, Transcription factor AP-2-delta, Activating enhancer-binding protein 2-delta, Transcription factor AP-2-beta-like 1) (AP)

Sign In for Pricing
View Details
TFAP2D, CT (TFAP2D, TFAP2BL1, Transcription factor AP-2-delta, Activating enhancer-binding protein 2-delta, Transcription factor AP-2-beta-like 1) (AP)
MBS6354964-02 5x 0.2 mL

TFAP2D, CT (TFAP2D, TFAP2BL1, Transcription factor AP-2-delta, Activating enhancer-binding protein 2-delta, Transcription factor AP-2-beta-like 1) (AP)

Sign In for Pricing
View Details
ABCF1 discontinued
385178 200 µL

ABCF1 discontinued

Sign In for Pricing
View Details
SUMO2/3 Antibody
V7091IHC-7ML 7 mL

SUMO2/3 Antibody

Sign In for Pricing
View Details
Anti-CD340/ERBB2/HER2/NEU (CRX02) Biosimilar (Monoclonal, IgG)
A136343 100 µL

Anti-CD340/ERBB2/HER2/NEU (CRX02) Biosimilar (Monoclonal, IgG)

Sign In for Pricing
View Details