Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBX8 Rabbit Polyclonal Antibody (Biotin)

CBX8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PC3, RC1

UniProt

Q9HC52

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CBX8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ARILGDPEEESWSPSLTNLEKVVVTDVTSNFLTVTIKESNTDQGFFKEKR

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065700

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycoplasma pneumoniae Lon protease (lon), partial
MBS9424037-01 0.02 mg

Recombinant Mycoplasma pneumoniae Lon protease (lon), partial

Sign In for Pricing
View Details
Recombinant Mycoplasma pneumoniae Lon protease (lon), partial
MBS9424037-02 0.1 mg

Recombinant Mycoplasma pneumoniae Lon protease (lon), partial

Sign In for Pricing
View Details
Recombinant Mycoplasma pneumoniae Lon protease (lon), partial
MBS9424037-03 1 mg

Recombinant Mycoplasma pneumoniae Lon protease (lon), partial

Sign In for Pricing
View Details
Recombinant Mycoplasma pneumoniae Lon protease (lon), partial
MBS9424037-04 5x 1 mg

Recombinant Mycoplasma pneumoniae Lon protease (lon), partial

Sign In for Pricing
View Details
Goat receptortyrosinekinase (RTKs) ELISA Kit
EIA06305Go 1 Kit

Goat receptortyrosinekinase (RTKs) ELISA Kit

Sign In for Pricing
View Details
Gbp10 (NM_001039646) Mouse Untagged Clone
MC219679 10 µg

Gbp10 (NM_001039646) Mouse Untagged Clone

Sign In for Pricing
View Details