Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF286B Rabbit Polyclonal Antibody (HRP)

ZNF286B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FOXO3B, ZNF590, ZNF286C, ZNF286L

UniProt

P0CG31

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF286B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SPHFQEKSTEEGEVAALRLTARSQAAAAAAAPGSRSLRGVHVPPPLHPAP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001138517

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Hydroxy-3- (2-thienyl) propyl]methylcarbamic Acid 1,1-Dimethylethyl Ester
425948-01 10 mg

3-Hydroxy-3- (2-thienyl) propyl]methylcarbamic Acid 1,1-Dimethylethyl Ester

Sign In for Pricing
View Details
3-Hydroxy-3- (2-thienyl) propyl]methylcarbamic Acid 1,1-Dimethylethyl Ester
425948-02 25 mg

3-Hydroxy-3- (2-thienyl) propyl]methylcarbamic Acid 1,1-Dimethylethyl Ester

Sign In for Pricing
View Details
Human LIPG Pre-designed siRNA Set B
SI008750B 1 Each

Human LIPG Pre-designed siRNA Set B

Sign In for Pricing
View Details
Recombinant Human TMEFF2 Protein, N-His
HV551012-01 50 µg

Recombinant Human TMEFF2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TMEFF2 Protein, N-His
HV551012-02 100 µg

Recombinant Human TMEFF2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TMEFF2 Protein, N-His
HV551012-03 1 mg

Recombinant Human TMEFF2 Protein, N-His

Sign In for Pricing
View Details