Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF304 Rabbit Polyclonal Antibody (FITC)

ZNF304 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MGC129703, MGC129704

UniProt

Q9HCX3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF304

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MAAAVLMDRVQSCVTFEDVFVYFSREEWELLEEAQRFLYRDVMLENFALV

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_065708

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Xenopus laevis Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (zcrb1)
MBS1447105-01 0.02 mg (E-Coli)

Recombinant Xenopus laevis Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (zcrb1)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (zcrb1)
MBS1447105-02 0.1 mg (E-Coli)

Recombinant Xenopus laevis Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (zcrb1)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (zcrb1)
MBS1447105-03 0.02 mg (Yeast)

Recombinant Xenopus laevis Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (zcrb1)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (zcrb1)
MBS1447105-04 0.1 mg (Yeast)

Recombinant Xenopus laevis Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (zcrb1)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (zcrb1)
MBS1447105-05 0.02 mg (Baculovirus)

Recombinant Xenopus laevis Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (zcrb1)

Sign In for Pricing
View Details
Recombinant Xenopus laevis Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (zcrb1)
MBS1447105-06 0.02 mg (Mammalian-Cell)

Recombinant Xenopus laevis Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (zcrb1)

Sign In for Pricing
View Details