Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB2 Rabbit Polyclonal Antibody (HRP)

ZBTB2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF437

UniProt

Q8N680

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZBTB2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VKHSCQNQNSDVFALDEGRSILLGSGDSEVTEPDHPVLASIKKEQETVLL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065912

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLC43A3 activation kit by CRISPRa
GA109201 1 Kit

Human SLC43A3 activation kit by CRISPRa

Sign In for Pricing
View Details
Uncoated Human S100A9 (S100 Calcium Binding Protein A9) ELISA Kit
E-UNEL-H0199-01 5x 96 Tests

Uncoated Human S100A9 (S100 Calcium Binding Protein A9) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human S100A9 (S100 Calcium Binding Protein A9) ELISA Kit
E-UNEL-H0199-02 15x 96 Tests

Uncoated Human S100A9 (S100 Calcium Binding Protein A9) ELISA Kit

Sign In for Pricing
View Details
Zfp101 Mouse Gene Knockout Kit (CRISPR)
KN519714 1 Kit

Zfp101 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human TROY (TNFRSF19) activation kit by CRISPRa
GA110763 1 Kit

Human TROY (TNFRSF19) activation kit by CRISPRa

Sign In for Pricing
View Details
MAPKAP Kinase 3 (MAPKAPK3) Rabbit Polyclonal Antibody
TA370884 100 µL

MAPKAP Kinase 3 (MAPKAPK3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details