Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL1 Rabbit Polyclonal Antibody (Biotin)

KLHL1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MRP2

UniProt

Q9NR64

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KLHL1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: APLSMPRDAVGVCLLGDRLYAVGGYDGQTYLNTMESYDPQTNEWTQMASL

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065917

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AF 488 Goat Anti-Rabbit IgG (H+L)
Y1048 100 µL

AF 488 Goat Anti-Rabbit IgG (H+L)

Sign In for Pricing
View Details
APAF1 (Apoptosis Protease Activating Factor 1) BioAssayTM ELISA Kit (Human) discontinued
353990-01 48 Tests

APAF1 (Apoptosis Protease Activating Factor 1) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
APAF1 (Apoptosis Protease Activating Factor 1) BioAssayTM ELISA Kit (Human) discontinued
353990-02 96 Tests

APAF1 (Apoptosis Protease Activating Factor 1) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
D-Dopachrome Tautomerase (DDT) Chicken ELISA Kit
C8288 96 Tests

D-Dopachrome Tautomerase (DDT) Chicken ELISA Kit

Sign In for Pricing
View Details
Lentiviral human TAF1B sgRNA gene knockout kit - Lentiviral human TAF1B sgRNA gene knockout kit (plasmid)
GTR15401408 1 Vial

Lentiviral human TAF1B sgRNA gene knockout kit - Lentiviral human TAF1B sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
TDT, NT (DNTT, TDT, DNA nucleotidylexotransferase, Terminal addition enzyme, Terminal deoxynucleotidyltransferase) (FITC)
MBS6354670-01 0.2 mL

TDT, NT (DNTT, TDT, DNA nucleotidylexotransferase, Terminal addition enzyme, Terminal deoxynucleotidyltransferase) (FITC)

Sign In for Pricing
View Details