Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB26 Rabbit Polyclonal Antibody (HRP)

ZBTB26 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF481, bioref

UniProt

Q9HCK0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZBTB26

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSERSDLLHFKFENYGDSMLQKMNKLREENKFCDVTVLIDDIEVQGHKIV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065975

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plasmid DNA Midi Endotoxin Removal kit (25 prep)-spin column
FAPDE-005B-025 25 Preparations

Plasmid DNA Midi Endotoxin Removal kit (25 prep)-spin column

Sign In for Pricing
View Details
WIPI2 Antibody (C-term)
MBS9207721-01 0.08 mL

WIPI2 Antibody (C-term)

Sign In for Pricing
View Details
WIPI2 Antibody (C-term)
MBS9207721-02 0.4 mL

WIPI2 Antibody (C-term)

Sign In for Pricing
View Details
WIPI2 Antibody (C-term)
MBS9207721-03 5x 0.4 mL

WIPI2 Antibody (C-term)

Sign In for Pricing
View Details
Human Total HSP27 DuoSet ELISA IC 5 Plate
DYC1580-5 5 Plates

Human Total HSP27 DuoSet ELISA IC 5 Plate

Sign In for Pricing
View Details
PLIN2 (ADFP, Perilipin-2, Adipophilin, Adipose Differentiation-related Protein, ADRP) discontinued
P3341-03 50 µL

PLIN2 (ADFP, Perilipin-2, Adipophilin, Adipose Differentiation-related Protein, ADRP) discontinued

Sign In for Pricing
View Details