Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF317 Rabbit Polyclonal Antibody (HRP)

ZNF317 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KIAA1588

UniProt

Q96PQ6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF317

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HRRIHTGEKPYECLVCGKAFSDHSSLRSHVKTHRGEKLFVSSVWKRLQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065984

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p15 INK4b (CDKN2B) Human Gene Knockout Kit (CRISPR)
KN204895BN 1 Kit

p15 INK4b (CDKN2B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Colony Stimulating Factor 2, Granulocyte Macrophage (GMCSF) ELISA Kit
RD-GMCSF-Mu-01 96 Tests

Mouse Colony Stimulating Factor 2, Granulocyte Macrophage (GMCSF) ELISA Kit

Sign In for Pricing
View Details
Mouse Colony Stimulating Factor 2, Granulocyte Macrophage (GMCSF) ELISA Kit
RD-GMCSF-Mu-02 48 Tests

Mouse Colony Stimulating Factor 2, Granulocyte Macrophage (GMCSF) ELISA Kit

Sign In for Pricing
View Details
MHC II (HLA-DRA) (19-26.1), Biotin conjugate, 0.1mg/mL
BNCB1082-500 1x 500 µL

MHC II (HLA-DRA) (19-26.1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ctla4 Mouse Gene Knockout Kit (CRISPR)
KN303962 1 Kit

Ctla4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human MEX3D activation kit by CRISPRa
GA118243 1 Kit

Human MEX3D activation kit by CRISPRa

Sign In for Pricing
View Details