Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF529 Rabbit Polyclonal Antibody (FITC)

ZNF529 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KIAA1615

UniProt

Q6P280

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF529

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TGEKPYECKACGKAFRHSSSFTKHQRIHTDDKPYECKECGNSFSVVGHLT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_066002

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl 4- (4-ethoxyphenyl) -2-indol-3-yl-4-oxobutanoate
FM169726 5000 mg

Methyl 4- (4-ethoxyphenyl) -2-indol-3-yl-4-oxobutanoate

Sign In for Pricing
View Details
Mouse CHIT1 EZ-Set™ ELISA Kit (DIY Antibody Pairs)
EZ2033 5 Plates/Kit

Mouse CHIT1 EZ-Set™ ELISA Kit (DIY Antibody Pairs)

Sign In for Pricing
View Details
SGIP1, NT (SGIP1, SH3-containing GRB2-like protein 3-interacting protein 1, Endophilin-3-interacting protein) (MaxLight 490)
MBS6346873-01 0.1 mL

SGIP1, NT (SGIP1, SH3-containing GRB2-like protein 3-interacting protein 1, Endophilin-3-interacting protein) (MaxLight 490)

Sign In for Pricing
View Details
SGIP1, NT (SGIP1, SH3-containing GRB2-like protein 3-interacting protein 1, Endophilin-3-interacting protein) (MaxLight 490)
MBS6346873-02 5x 0.1 mL

SGIP1, NT (SGIP1, SH3-containing GRB2-like protein 3-interacting protein 1, Endophilin-3-interacting protein) (MaxLight 490)

Sign In for Pricing
View Details
Herpes Simplex Virus I, II, Glycoprotein D (HSV I, II, Herpes Simplex Virus 1, HSV1, Herpes Simplex Virus 2, HSV2) (MaxLight 490)
353475-ML490 100 µL

Herpes Simplex Virus I, II, Glycoprotein D (HSV I, II, Herpes Simplex Virus 1, HSV1, Herpes Simplex Virus 2, HSV2) (MaxLight 490)

Sign In for Pricing
View Details
Anti-Zebrafish STAT3 Antibody Picoband® HRP Conjugated
AZA0A8M2BAX1-HRP 100 µg/Vial

Anti-Zebrafish STAT3 Antibody Picoband® HRP Conjugated

Sign In for Pricing
View Details