Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF537 Rabbit Polyclonal Antibody (Biotin)

ZNF537 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TSH3, ZNF537

UniProt

Q9H0G6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF537

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LNVEVKKEVDKEKAVTDEKPKQKDKPGEEEEKCDISSKYHYLTENDLEES

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

98kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_065907

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Lambda Light Chain (LcN-2), CF740 conjugate, 0.1mg/mL
BNC740631-500 1x 500 µL

Human Lambda Light Chain (LcN-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/413), CF594 conjugate, 0.1mg/mL
BNC941906-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (rCHGA/413), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD19 (CVID3/155), 1mg/mL
BNUM0155-50 1x 50 µL

CD19 (CVID3/155), 1mg/mL

Sign In for Pricing
View Details
Cell Meter™ Phosphatidylserine Apoptosis Assay Kit *Deep Red Fluorescence Optimized for Flow Cytometry*
22832-AAT 100 Tests

Cell Meter™ Phosphatidylserine Apoptosis Assay Kit *Deep Red Fluorescence Optimized for Flow Cytometry*

Sign In for Pricing
View Details
TPD52 Antibody
8C10745-AAT 50 µg

TPD52 Antibody

Sign In for Pricing
View Details
HCG-beta (Pregnancy & Choriocarcinoma Marker) (HCGb/1985R), 0.2mg/mL
BNUB1985-100 1x 100 µL

HCG-beta (Pregnancy & Choriocarcinoma Marker) (HCGb/1985R), 0.2mg/mL

Sign In for Pricing
View Details