Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prrx2 Rabbit Polyclonal Antibody (HRP)

Prrx2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

S, Pr, S8, Prx2

UniProt

Q06348

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Prrx2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AKFRRNERAMLATRSASLLKSYGQEAAIEQPVAPRPTTMSPDYLSWPASS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033142

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Semaphorin 3B/SEMA3B Antibody Picoband® (monoclonal, 9C4F7) Fluoro594 Conjugated
M06559-Fluoro594 100 µg/Vial

Anti-Semaphorin 3B/SEMA3B Antibody Picoband® (monoclonal, 9C4F7) Fluoro594 Conjugated

Sign In for Pricing
View Details
Fbxo6 Rat shRNA Plasmid (Locus ID 192351)
TL712970 1 Kit

Fbxo6 Rat shRNA Plasmid (Locus ID 192351)

Sign In for Pricing
View Details
TUBA1C Protein Lysate (Human) with C-Ha Tag
48793033 100 µg

TUBA1C Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
PIP5K3 (PIKFYVE) Mouse Monoclonal Antibody [Clone:1D3]
E45M19588 100 µg

PIP5K3 (PIKFYVE) Mouse Monoclonal Antibody [Clone:1D3]

Sign In for Pricing
View Details
Human C16orf87 siRNA
abx909565-01 15 nmol

Human C16orf87 siRNA

Sign In for Pricing
View Details
Human C16orf87 siRNA
abx909565-02 30 nmol

Human C16orf87 siRNA

Sign In for Pricing
View Details