Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCCA Rabbit Polyclonal Antibody (FITC)

PCCA Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q8WXQ7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PCCA

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LYYSRQCLMVSRNLGSVGYDPNEKTFDKILVANRGEIACRVIRTCKKMGI

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_000273

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human low-density lipoprotein-receptor-related protein 4,LRP-4 antibody,IgG ELISA KIT
JOT-EKD0354Hu 96 wells

Human low-density lipoprotein-receptor-related protein 4,LRP-4 antibody,IgG ELISA KIT

Sign In for Pricing
View Details
Camel Chemokine C-C-Motif Ligand 3 Like Protein 1 ELISA Kit
MBS081777-01 48 Well

Camel Chemokine C-C-Motif Ligand 3 Like Protein 1 ELISA Kit

Sign In for Pricing
View Details
Camel Chemokine C-C-Motif Ligand 3 Like Protein 1 ELISA Kit
MBS081777-02 96 Well

Camel Chemokine C-C-Motif Ligand 3 Like Protein 1 ELISA Kit

Sign In for Pricing
View Details
Camel Chemokine C-C-Motif Ligand 3 Like Protein 1 ELISA Kit
MBS081777-03 5x 96 Well

Camel Chemokine C-C-Motif Ligand 3 Like Protein 1 ELISA Kit

Sign In for Pricing
View Details
Camel Chemokine C-C-Motif Ligand 3 Like Protein 1 ELISA Kit
MBS081777-04 10x 96 Well

Camel Chemokine C-C-Motif Ligand 3 Like Protein 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Prr3 Pre-designed siRNA Set A
SI111235A 1 Each

Mouse Prr3 Pre-designed siRNA Set A

Sign In for Pricing
View Details