Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JMJD4 Rabbit Polyclonal Antibody (HRP)

JMJD4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ12517, MGC129896

UniProt

Q9H9V9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human JMJD4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AAFDVGRITEVLASLVAHPDFQRVDTSAFSPQPKELLQQLREAVDAAAAP

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_075383

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human uPRT Recombinant Protein
PROTQ96BW1-250ug 250 µg

Human uPRT Recombinant Protein

Sign In for Pricing
View Details
Horse Stem Cell Factor Receptor ELISA Kit
MBS047245-01 48 Well

Horse Stem Cell Factor Receptor ELISA Kit

Sign In for Pricing
View Details
Horse Stem Cell Factor Receptor ELISA Kit
MBS047245-02 96 Well

Horse Stem Cell Factor Receptor ELISA Kit

Sign In for Pricing
View Details
Horse Stem Cell Factor Receptor ELISA Kit
MBS047245-03 5x 96 Well

Horse Stem Cell Factor Receptor ELISA Kit

Sign In for Pricing
View Details
Horse Stem Cell Factor Receptor ELISA Kit
MBS047245-04 10x 96 Well

Horse Stem Cell Factor Receptor ELISA Kit

Sign In for Pricing
View Details
C9orf153 Protein Vector (Human) (pPM-C-His)
PV066992 500 ng

C9orf153 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details