Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF447 Rabbit Polyclonal Antibody (FITC)

ZNF447 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZNF447

UniProt

Q8TBC5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF447

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PADLEFSRLRFREFVYQEAAGPHQTLARLHELCRQWLMPEARSKEQMLEL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_076415

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr996 (NM_146437) Mouse Tagged ORF Clone
MR215080 10 µg

Olfr996 (NM_146437) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
1000 ug/mL Isocarbophos in HPLC Acetonitrile - 1ML
LCS-6275 1 mL

1000 ug/mL Isocarbophos in HPLC Acetonitrile - 1ML

Sign In for Pricing
View Details
Malignant fibrous histiocytoma (MFHAS1) (NM_004225) Human Tagged ORF Clone Lentiviral Particle
RC224081L3V 200 µL

Malignant fibrous histiocytoma (MFHAS1) (NM_004225) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YLR157W-D (YLR157W-D)
MBS1084810-01 0.02 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YLR157W-D (YLR157W-D)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YLR157W-D (YLR157W-D)
MBS1084810-02 0.1 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YLR157W-D (YLR157W-D)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YLR157W-D (YLR157W-D)
MBS1084810-03 0.02 mg (Yeast)

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YLR157W-D (YLR157W-D)

Sign In for Pricing
View Details