Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C20ORF20 Rabbit Polyclonal Antibody (HRP)

C20ORF20 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Eaf7, URCC4, MRG15BP, C20orf20

UniProt

Q9NV56

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C20ORF20

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVG

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_060740

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYorf15A (NM_001005852) Human Tagged ORF Clone
RC211067 10 µg

CYorf15A (NM_001005852) Human Tagged ORF Clone

Sign In for Pricing
View Details
EGTA tetrasodium
sc-252773 10 g

EGTA tetrasodium

Sign In for Pricing
View Details
Lentiviral mouse Slc16a6 shRNA (UAS) - Lentiviral mouse Slc16a6 shRNA (UAS, iRFP) (100)
GTR15216087 1 Vial

Lentiviral mouse Slc16a6 shRNA (UAS) - Lentiviral mouse Slc16a6 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Recombinant Ictalurid herpesvirus 1 Uncharacterized protein ORF35 (ORF35)
MBS1205013-01 0.02 mg (E-Coli)

Recombinant Ictalurid herpesvirus 1 Uncharacterized protein ORF35 (ORF35)

Sign In for Pricing
View Details
Recombinant Ictalurid herpesvirus 1 Uncharacterized protein ORF35 (ORF35)
MBS1205013-02 0.1 mg (E-Coli)

Recombinant Ictalurid herpesvirus 1 Uncharacterized protein ORF35 (ORF35)

Sign In for Pricing
View Details
Recombinant Ictalurid herpesvirus 1 Uncharacterized protein ORF35 (ORF35)
MBS1205013-03 0.02 mg (Yeast)

Recombinant Ictalurid herpesvirus 1 Uncharacterized protein ORF35 (ORF35)

Sign In for Pricing
View Details