Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PKNOX2 Rabbit Polyclonal Antibody (Biotin)

PKNOX2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PREP2

UniProt

Q9H921

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PKNOX2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ATQNVPPPPYQDSPQMTATAQPPSKAQAVHISAPSAAASTPVPSAPIDPQ

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_071345

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Caspase-5/CASP5 Antibody Picoband®, Cy3 Conjugate
A05259-4-Cy3 100 µg/Vial

Anti-Caspase-5/CASP5 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
EphB1 (Ephrin Type-B Receptor 1, Tyrosine-protein Kinase Receptor EPH-2, NET, EPH-like Kinase 6, EK6, hEK6, HEK-6, EPHT2)
MBS627715-01 0.2 mL

EphB1 (Ephrin Type-B Receptor 1, Tyrosine-protein Kinase Receptor EPH-2, NET, EPH-like Kinase 6, EK6, hEK6, HEK-6, EPHT2)

Sign In for Pricing
View Details
EphB1 (Ephrin Type-B Receptor 1, Tyrosine-protein Kinase Receptor EPH-2, NET, EPH-like Kinase 6, EK6, hEK6, HEK-6, EPHT2)
MBS627715-02 5x 0.2 mL

EphB1 (Ephrin Type-B Receptor 1, Tyrosine-protein Kinase Receptor EPH-2, NET, EPH-like Kinase 6, EK6, hEK6, HEK-6, EPHT2)

Sign In for Pricing
View Details
Mouse Anti-Mullerian hormone (AMH) ELISA Kit
MBS268824-01 48 Well

Mouse Anti-Mullerian hormone (AMH) ELISA Kit

Sign In for Pricing
View Details
Mouse Anti-Mullerian hormone (AMH) ELISA Kit
MBS268824-02 96 Well

Mouse Anti-Mullerian hormone (AMH) ELISA Kit

Sign In for Pricing
View Details
Mouse Anti-Mullerian hormone (AMH) ELISA Kit
MBS268824-03 5x 96 Well

Mouse Anti-Mullerian hormone (AMH) ELISA Kit

Sign In for Pricing
View Details