Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP36L1 Rabbit Polyclonal Antibody (FITC)

ZFP36L1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BRF1, ERF1, cMG1, ERF-1, Berg36, TIS11B, RNF162B

UniProt

Q07352

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP36L1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGG

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_004917

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cpd Mouse Gene Knockout Kit (CRISPR)
KN503747 1 Kit

Cpd Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
gamma Adaptin (AP1G1) (NM_001030007) Human Over-expression Lysate
LC422287 20 µg

gamma Adaptin (AP1G1) (NM_001030007) Human Over-expression Lysate

Sign In for Pricing
View Details
AMBN Human Gene Knockout Kit (CRISPR)
KN421219 1 Kit

AMBN Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Milk Fat Globulin (EDM45), CF568 conjugate, 0.1mg/mL
BNC680942-100 1x 100 µL

Milk Fat Globulin (EDM45), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Semenogelin I (SEMG1) ELISA Kit
RD-SEMG1-Hu-01 96 Tests

Human Semenogelin I (SEMG1) ELISA Kit

Sign In for Pricing
View Details
Human Semenogelin I (SEMG1) ELISA Kit
RD-SEMG1-Hu-02 48 Tests

Human Semenogelin I (SEMG1) ELISA Kit

Sign In for Pricing
View Details