Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBX6 Rabbit Polyclonal Antibody (HRP)

TBX6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SCDO5

UniProt

O95947

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TBX6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AHPPLPLLPPAMGTEPAPSAPEALHSLPGVSLSLENRELWKEFSSVGTEM

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_004599

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EXT2 Rabbit Polyclonal Antibody
TA376042 100 µL

EXT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WDR85 (DPH7) (NM_138778) Human Recombinant Protein
TP305735L 1 mg

WDR85 (DPH7) (NM_138778) Human Recombinant Protein

Sign In for Pricing
View Details
CO2 Incubator Water Jacketed BCWJ-8302
BCWJ-8302 1 Unit

CO2 Incubator Water Jacketed BCWJ-8302

Sign In for Pricing
View Details
Human SLC9C1 activation kit by CRISPRa
GA117213 1 Kit

Human SLC9C1 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS643559 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Prxl2c Mouse Gene Knockout Kit (CRISPR)
KN500580 1 Kit

Prxl2c Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details