Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Utx Rabbit Polyclonal Antibody (FITC)

Utx Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Utx

UniProt

O70546

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ATILQQLGWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

154kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033509

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NLGN4X Rabbit Polyclonal Antibody
orb580778 100 µL

NLGN4X Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD63 (gp55, granulophysin, Lysosomal-associated membrane protein 3 (LAMP-3), Mast cell antigen AD1, melanoma 1 antigen, Melanoma-associated antigen MLA1, Melanoma-associated antigen ME491, MLA1, NGA, Ocular melanoma-associated antigen, OMA81H, PTLGP40, Tetraspanin-30, TSPAN30) (BSA & Azide Free) (MaxLight 405) discontinued
168713-AF-ML405 100 µL

CD63 (gp55, granulophysin, Lysosomal-associated membrane protein 3 (LAMP-3), Mast cell antigen AD1, melanoma 1 antigen, Melanoma-associated antigen MLA1, Melanoma-associated antigen ME491, MLA1, NGA, Ocular melanoma-associated antigen, OMA81H, PTLGP40, Tetraspanin-30, TSPAN30) (BSA & Azide Free) (MaxLight 405) discontinued

Sign In for Pricing
View Details
PRY 3'UTR Luciferase Stable Cell Line
TU018988 1.0 mL

PRY 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Olfr418-ps1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
33138064 1.0 µg DNA

Olfr418-ps1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
FTSJ1 Polyclonal Antibody, APC Conjugated
bs-12264R-APC 100 µL

FTSJ1 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal Proteasome 19S S5A Antibody
NBP2-19952 0.1 mL

Rabbit Polyclonal Proteasome 19S S5A Antibody

Sign In for Pricing
View Details