Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF76 Rabbit Polyclonal Antibody (HRP)

ZNF76 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF523, Zfp523, D6S229E

UniProt

P36508

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF76

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MHKRSAHGELEATEESEQALYEQQQLEAASAAEESPPPKRPRIAYLSEVK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003418

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Perfringens adk Protein (aa 1-218)
VAng-Lsx00272-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Perfringens adk Protein (aa 1-218)

Sign In for Pricing
View Details
CD5 Mouse Monoclonal Antibody [Clone 5G10]
E45M15502V-2 50 µL

CD5 Mouse Monoclonal Antibody [Clone 5G10]

Sign In for Pricing
View Details
AKR1B1 Rabbit pAb
E45R20505N 50 ul

AKR1B1 Rabbit pAb

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Chordin Like Protein 2 (CHRDL2)
MBS2076969-01 0.1 mL

FITC-Linked Polyclonal Antibody to Chordin Like Protein 2 (CHRDL2)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Chordin Like Protein 2 (CHRDL2)
MBS2076969-02 0.2 mL

FITC-Linked Polyclonal Antibody to Chordin Like Protein 2 (CHRDL2)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Chordin Like Protein 2 (CHRDL2)
MBS2076969-03 0.5 mL

FITC-Linked Polyclonal Antibody to Chordin Like Protein 2 (CHRDL2)

Sign In for Pricing
View Details