Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF205 Rabbit Polyclonal Antibody (Biotin)

ZNF205 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RhitH, Zfp13, ZNF210

UniProt

O95201

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZN205

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LSREEWGRLDHTQQNFYRDVLQKKNGLSLGFPFSRPFWAPQAHGKGEASG

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

XP_005255615

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gon4l 3'UTR GFP Stable Cell Line
TU255265 1.0 mL

Gon4l 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
WDR5 (WD Repeat Domain 5 Protein, SWD3, BIG-3) (MaxLight 650)
MBS6443389-01 0.1 mL

WDR5 (WD Repeat Domain 5 Protein, SWD3, BIG-3) (MaxLight 650)

Sign In for Pricing
View Details
WDR5 (WD Repeat Domain 5 Protein, SWD3, BIG-3) (MaxLight 650)
MBS6443389-02 5x 0.1 mL

WDR5 (WD Repeat Domain 5 Protein, SWD3, BIG-3) (MaxLight 650)

Sign In for Pricing
View Details
CSAG4 CRISPR Knock Out 293T Cell Line (Human)
16905141 1x 10^6 Cells / 1.0 mL

CSAG4 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Gpr157 (NM_177366) Mouse Tagged ORF Clone Lentiviral Particle
MR216036L4V 200 µL

Gpr157 (NM_177366) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PCBP2 Antibody [L1D11]
C15804-20uL 20 µL

PCBP2 Antibody [L1D11]

Sign In for Pricing
View Details