Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hmbox1 Rabbit Polyclonal Antibody (HRP)

Hmbox1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI451877, AI604847, F830020C16Rik

UniProt

Q8BJA3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ECLAVMESYFNENQYPDEAKREEIANACNAVIQKPGKKLSDLERVTSLKV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_796312

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAD+100MG Freeze-dried powder
NJ1000 1000 mg x 10 Vials

NAD+100MG Freeze-dried powder

Sign In for Pricing
View Details
Iso-Amyl Alcohol 99% AR
25701000 1 L

Iso-Amyl Alcohol 99% AR

Sign In for Pricing
View Details
Recombinant Dichelobacter nodosus 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH)
MBS1072136-01 0.02 mg (E-Coli)

Recombinant Dichelobacter nodosus 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH)

Sign In for Pricing
View Details
Recombinant Dichelobacter nodosus 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH)
MBS1072136-02 0.02 mg (Yeast)

Recombinant Dichelobacter nodosus 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH)

Sign In for Pricing
View Details
Recombinant Dichelobacter nodosus 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH)
MBS1072136-03 0.1 mg (E-Coli)

Recombinant Dichelobacter nodosus 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH)

Sign In for Pricing
View Details
Recombinant Dichelobacter nodosus 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH)
MBS1072136-04 0.1 mg (Yeast)

Recombinant Dichelobacter nodosus 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH)

Sign In for Pricing
View Details