Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF436 Rabbit Polyclonal Antibody (FITC)

ZNF436 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZNF, Zfp46

UniProt

Q9C0F3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF436

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RQWGDLTAEEWVSYPLQPVTDLLVHKEVHTGIRYHICSHCGKAFSQISDL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_085137

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SMIM20 sgRNA gene knockout kit - Lentiviral human SMIM20 sgRNA gene knockout kit (100)
GTR15370660 1 Vial

Lentiviral human SMIM20 sgRNA gene knockout kit - Lentiviral human SMIM20 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
SUGT1, CT (SUGT1, Suppressor of G2 allele of SKP1 homolog, Protein 40-6-3, Sgt1) (FITC)
MBS6352459-01 0.2 mL

SUGT1, CT (SUGT1, Suppressor of G2 allele of SKP1 homolog, Protein 40-6-3, Sgt1) (FITC)

Sign In for Pricing
View Details
SUGT1, CT (SUGT1, Suppressor of G2 allele of SKP1 homolog, Protein 40-6-3, Sgt1) (FITC)
MBS6352459-02 5x 0.2 mL

SUGT1, CT (SUGT1, Suppressor of G2 allele of SKP1 homolog, Protein 40-6-3, Sgt1) (FITC)

Sign In for Pricing
View Details
ANKRD20A6P Protein Vector (Human) (pPM-N-D-C-His)
PV321993 500 ng

ANKRD20A6P Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
GSTp1 Polyclonal Antibody
D-AB-10211L-01 25 µL

GSTp1 Polyclonal Antibody

Sign In for Pricing
View Details
GSTp1 Polyclonal Antibody
D-AB-10211L-02 100 µL

GSTp1 Polyclonal Antibody

Sign In for Pricing
View Details