Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF92 Rabbit Polyclonal Antibody (Biotin)

ZNF92 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TF12, HPF12, HTF12, HEL-203

UniProt

Q03936

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human ZNF92

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TLTKHKRIHTGEKPYKCEECGKAFKQSSTLTEHKIIHTGEKPYKCEKCGK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Humanin (HN) (Not for Export EU)
H7953-30F1 100 µL

Humanin (HN) (Not for Export EU)

Sign In for Pricing
View Details
DAP3 Antibody
orb1281373 100 µL

DAP3 Antibody

Sign In for Pricing
View Details
KRT8P30 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1168805 3x 1.0 µg

KRT8P30 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Clostridium Perfringens luxS Protein (aa 1-151) (strain SM101 / Type A)
VAng-Lsx01080-50gEcoli 50 µg (E. coli)

Recombinant Clostridium Perfringens luxS Protein (aa 1-151) (strain SM101 / Type A)

Sign In for Pricing
View Details
β-synuclein HDR Plasmid (m)
sc-430508-HDR 20 µg

β-synuclein HDR Plasmid (m)

Sign In for Pricing
View Details
ELISA kit for Human EMILIN1 (Elastin Microfibril Interface Located Protein 1)
E-EL-H1166 96 Tests

ELISA kit for Human EMILIN1 (Elastin Microfibril Interface Located Protein 1)

Sign In for Pricing
View Details