Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLK6 Rabbit Polyclonal Antibody (HRP)

KLK6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HK6, Bssp, Klk7, SP59, PRSS9, PRSS18

UniProt

Q92876

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KLK6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human

Tested Applications

IHC, WB

NCBI Accession Number

NP_001012982

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (NAT105), CF488A conjugate, 0.1mg/mL
BNC880896-500 1x 500 µL

PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (NAT105), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human BLAP75 (RMI1) activation kit by CRISPRa
GA112786 1 Kit

Human BLAP75 (RMI1) activation kit by CRISPRa

Sign In for Pricing
View Details
ZNF208 Human Gene Knockout Kit (CRISPR)
KN420711 1 Kit

ZNF208 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse IL-4 Recombinant Rabbit Monoclonal Antibody [PSH05-34] - BSA and Azide free (Detector)
HA722263 100 µg

Mouse IL-4 Recombinant Rabbit Monoclonal Antibody [PSH05-34] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
Bulk Anti-Human PD-L2 (3.2) Antibody
ICH1031-100mg 100 mg

Bulk Anti-Human PD-L2 (3.2) Antibody

Sign In for Pricing
View Details
ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (ATRX/2900R), CF568 conjugate, 0.1mg/mL
BNC682900-100 1x 100 µL

ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (ATRX/2900R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details