Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Trp63 Rabbit Polyclonal Antibody (Biotin)

Trp63 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P6, p7, Ket, P63, TAp, P73l, Tp63, Trp5, delta, p51/p, P51/P63, AI462811, Trp53rp1

UniProt

Q9H3D4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VTLETRDGQVLGRRCFEARICACPGRDRKADEDSIRKQQVSDSAKNGDGT

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001108450.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-2-aminophenylacetic acid ≥97% (HPLC)
237938-01 100 mg

Fmoc-2-aminophenylacetic acid ≥97% (HPLC)

Sign In for Pricing
View Details
Fmoc-2-aminophenylacetic acid ≥97% (HPLC)
237938-02 250 mg

Fmoc-2-aminophenylacetic acid ≥97% (HPLC)

Sign In for Pricing
View Details
Fmoc-2-aminophenylacetic acid ≥97% (HPLC)
237938-03 1 g

Fmoc-2-aminophenylacetic acid ≥97% (HPLC)

Sign In for Pricing
View Details
AP1AR 3'UTR Luciferase Stable Cell Line
TU000900 1.0 mL

AP1AR 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GALNT14, NT (GALNT14, Polypeptide N-acetylgalactosaminyltransferase 14, Polypeptide GalNAc transferase 14, Protein-UDP acetylgalactosaminyltransferase 14, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 14)
035890 200 µL

GALNT14, NT (GALNT14, Polypeptide N-acetylgalactosaminyltransferase 14, Polypeptide GalNAc transferase 14, Protein-UDP acetylgalactosaminyltransferase 14, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 14)

Sign In for Pricing
View Details
Rabbit anti-human chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) polyclonal Antibody
MBS710395-01 0.1 mL

Rabbit anti-human chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) polyclonal Antibody

Sign In for Pricing
View Details