Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTGER3 Rabbit Polyclonal Antibody (HRP)

PTGER3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EP3, EP3e, EP3-I, EP3-II, EP3-IV, EP3-VI, PGE2-R, EP3-III, lnc003875

UniProt

B1AK19

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PTGER3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QMRKRRLREQLICSLQNSQIQRATAHCGQVQTYRVLNREEMEVLVSSINV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_942011

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRDM16 (PR Domain Zinc Finger Protein 16, PR Domain-Containing Protein 16, Transcription Factor MEL1, MDS1/EVI1-like gene 1, PRDM16, KIAA1675, MEL1, PFM13) (AP) discontinued
302671-AP 200 µL

PRDM16 (PR Domain Zinc Finger Protein 16, PR Domain-Containing Protein 16, Transcription Factor MEL1, MDS1/EVI1-like gene 1, PRDM16, KIAA1675, MEL1, PFM13) (AP) discontinued

Sign In for Pricing
View Details
NUDT21 ORF Vector (Human) (pORF)
32296011 1.0 µg DNA

NUDT21 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
CDK10 discontinued
507940 100 µg

CDK10 discontinued

Sign In for Pricing
View Details
Recombinant Bacillus thuringiensis subsp. konkukian Probable nicotinate-nucleotide adenylyltransferase (nadD)
MBS1463205-01 0.02 mg (E-Coli)

Recombinant Bacillus thuringiensis subsp. konkukian Probable nicotinate-nucleotide adenylyltransferase (nadD)

Sign In for Pricing
View Details
Recombinant Bacillus thuringiensis subsp. konkukian Probable nicotinate-nucleotide adenylyltransferase (nadD)
MBS1463205-02 0.1 mg (E-Coli)

Recombinant Bacillus thuringiensis subsp. konkukian Probable nicotinate-nucleotide adenylyltransferase (nadD)

Sign In for Pricing
View Details
Recombinant Bacillus thuringiensis subsp. konkukian Probable nicotinate-nucleotide adenylyltransferase (nadD)
MBS1463205-03 0.02 mg (Yeast)

Recombinant Bacillus thuringiensis subsp. konkukian Probable nicotinate-nucleotide adenylyltransferase (nadD)

Sign In for Pricing
View Details