Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB40 Rabbit Polyclonal Antibody (Biotin)

ZBTB40 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZNF923

UniProt

Q9NUA8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZBTB40

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FPGALQHHVTTEHFKQSETTFPCELCGELFTSQAQLDSHLESEHPKVMST

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

138kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055685

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF89 Rabbit pAb
E47R9165 100 µL

RNF89 Rabbit pAb

Sign In for Pricing
View Details
Vmn2r57 (NM_177764) Mouse Tagged ORF Clone
MG221345 10 µg

Vmn2r57 (NM_177764) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
TRMT2B Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-16104R-BF488 100 µL

TRMT2B Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
ELISA Kit For Neuromedin-S
E1800h 96 Tests

ELISA Kit For Neuromedin-S

Sign In for Pricing
View Details
PLD6, ID (PLD6, Mitochondrial cardiolipin hydrolase, Choline phosphatase 6, Mitochondrial phospholipase, Phosphatidylcholine-hydrolyzing phospholipase D6, Phospholipase D6, Protein zucchini homolog) (Azide free) (HRP)
MBS6334788-01 0.2 mL

PLD6, ID (PLD6, Mitochondrial cardiolipin hydrolase, Choline phosphatase 6, Mitochondrial phospholipase, Phosphatidylcholine-hydrolyzing phospholipase D6, Phospholipase D6, Protein zucchini homolog) (Azide free) (HRP)

Sign In for Pricing
View Details
PLD6, ID (PLD6, Mitochondrial cardiolipin hydrolase, Choline phosphatase 6, Mitochondrial phospholipase, Phosphatidylcholine-hydrolyzing phospholipase D6, Phospholipase D6, Protein zucchini homolog) (Azide free) (HRP)
MBS6334788-02 5x 0.2 mL

PLD6, ID (PLD6, Mitochondrial cardiolipin hydrolase, Choline phosphatase 6, Mitochondrial phospholipase, Phosphatidylcholine-hydrolyzing phospholipase D6, Phospholipase D6, Protein zucchini homolog) (Azide free) (HRP)

Sign In for Pricing
View Details