Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Csrp2 Rabbit Polyclonal Antibody (HRP)

Csrp2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Cr, Sm, Crp2, SmLim, AW551867

UniProt

P97314

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IKPESAQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPW

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_031818

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alkaline Phosphatase (ALPP) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H2]
TA506374BM 100 µL

Alkaline Phosphatase (ALPP) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H2]

Sign In for Pricing
View Details
Mmu-miR-873a-3p mimic
HY-R04172-01 5 nmol

Mmu-miR-873a-3p mimic

Sign In for Pricing
View Details
Mmu-miR-873a-3p mimic
HY-R04172-02 20 nmol

Mmu-miR-873a-3p mimic

Sign In for Pricing
View Details
MUL1 shRNA (h) Lentiviral Particles
sc-78840-V 200 µL

MUL1 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
GALNT10 Protein Lysate (Human) with C-Ha Tag
21216031 100 µg

GALNT10 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Ell (NM_007924) Mouse Untagged Clone
MC202922 10 µg

Ell (NM_007924) Mouse Untagged Clone

Sign In for Pricing
View Details