Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Csrp2 Rabbit Polyclonal Antibody (HRP)

Csrp2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Cr, Sm, Crp2, SmLim, AW551867

UniProt

P97314

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IKPESAQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPW

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_031818

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biciromab (Reference antibody)
E55B0513 100 µg

Biciromab (Reference antibody)

Sign In for Pricing
View Details
S-Amphetamine Hemisulfate (1.0mg/ml in Methanol) discontinued
465552 51ml

S-Amphetamine Hemisulfate (1.0mg/ml in Methanol) discontinued

Sign In for Pricing
View Details
Mouse Epidermal Growth Factor (EGF) ELISA Kit
EIA05593m 1 Kit

Mouse Epidermal Growth Factor (EGF) ELISA Kit

Sign In for Pricing
View Details
SOAT2 sgRNA CRISPR Lentivector (Human) (Target 3)
K2256804 1.0 µg DNA

SOAT2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
VAPA Protein Vector (Human) (pPM-C-HA)
PV045639 500 ng

VAPA Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Desmoglein 1 Antibody / DSG1
V3260SAF-100UG 100 µg

Desmoglein 1 Antibody / DSG1

Sign In for Pricing
View Details