Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RTRAF Rabbit Polyclonal Antibody (FITC)

RTRAF Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CLE, CLE7, hCLE, CGI99, RLLM1, hCLE1, CGI-99, LCRP369, C14orf166

UniProt

Q9Y224

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C14orf166

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057123

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human YKT6 Knockout A549 cell line
GTR15407597 1 Vial

Human YKT6 Knockout A549 cell line

Sign In for Pricing
View Details
Rat HbA1C (Glycosylated Hemoglobin/Hemoglobin A1c) ELISA Kit
EKF57935 96 Tests

Rat HbA1C (Glycosylated Hemoglobin/Hemoglobin A1c) ELISA Kit

Sign In for Pricing
View Details
BRAF Antibody
orb1338494 100 µg

BRAF Antibody

Sign In for Pricing
View Details
ZNF446 Antibody
A39536-50UG 50 µg

ZNF446 Antibody

Sign In for Pricing
View Details
CD4 (CD4 Receptor, CD4mut, T Cell Surface Antigen T4/Leu3, T Cell Surface Glycoprotein CD4 (Azide Free) discontinued
C2255-28D 1 mg

CD4 (CD4 Receptor, CD4mut, T Cell Surface Antigen T4/Leu3, T Cell Surface Glycoprotein CD4 (Azide Free) discontinued

Sign In for Pricing
View Details
Human TSPO Pre-designed siRNA Set B
SI017494B 1 Each

Human TSPO Pre-designed siRNA Set B

Sign In for Pricing
View Details