Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF9 Rabbit Polyclonal Antibody (Biotin)

TAF9 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TAF2G, TAFII31, TAFII32, MGC:5067, TAFII-31, TAFII-32, TAFIID32, STAF31/32

UniProt

Q9Y3D8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TAF9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

ChIP, IHC, WB

NCBI Accession Number

NP_001015891

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

4632428N05Rik 3'UTR Luciferase Stable Cell Line
TU100605 1.0 mL

4632428N05Rik 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Liver Carboxylesterase 1/CES1 Mouse Monoclonal Antibody (PE)
orb2603328 100 µg

Liver Carboxylesterase 1/CES1 Mouse Monoclonal Antibody (PE)

Sign In for Pricing
View Details
E2F4/E2F5 (Transcription Factor E2F4, E2F-4, E2F4, Transcription Factor E2F5, E2F-5, E2F5) discontinued
222281-01 50 µL

E2F4/E2F5 (Transcription Factor E2F4, E2F-4, E2F4, Transcription Factor E2F5, E2F-5, E2F5) discontinued

Sign In for Pricing
View Details
E2F4/E2F5 (Transcription Factor E2F4, E2F-4, E2F4, Transcription Factor E2F5, E2F-5, E2F5) discontinued
222281-02 100 µL

E2F4/E2F5 (Transcription Factor E2F4, E2F-4, E2F4, Transcription Factor E2F5, E2F-5, E2F5) discontinued

Sign In for Pricing
View Details
KMT1B (H3 K9 HMTase 2, H3-K9-HMTase 2, Histone H3 K9 Methyltransferase 2, Histone H3-K9 Methyltransferase 2, Histone Lysine N Methyltransferase H3 Lysine 9 specific 2, Histone Lysine N Methyltransferase SUV39H2, Histone-Lysine N-methyltransferase) discontinued
360662-01 50 µL

KMT1B (H3 K9 HMTase 2, H3-K9-HMTase 2, Histone H3 K9 Methyltransferase 2, Histone H3-K9 Methyltransferase 2, Histone Lysine N Methyltransferase H3 Lysine 9 specific 2, Histone Lysine N Methyltransferase SUV39H2, Histone-Lysine N-methyltransferase) discontinued

Sign In for Pricing
View Details
KMT1B (H3 K9 HMTase 2, H3-K9-HMTase 2, Histone H3 K9 Methyltransferase 2, Histone H3-K9 Methyltransferase 2, Histone Lysine N Methyltransferase H3 Lysine 9 specific 2, Histone Lysine N Methyltransferase SUV39H2, Histone-Lysine N-methyltransferase) discontinued
360662-02 100 µL

KMT1B (H3 K9 HMTase 2, H3-K9-HMTase 2, Histone H3 K9 Methyltransferase 2, Histone H3-K9 Methyltransferase 2, Histone Lysine N Methyltransferase H3 Lysine 9 specific 2, Histone Lysine N Methyltransferase SUV39H2, Histone-Lysine N-methyltransferase) discontinued

Sign In for Pricing
View Details