Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDM11 Rabbit Polyclonal Antibody (FITC)

PRDM11 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PFM8

UniProt

Q9NQV5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human PRDM11

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IGQTQGEGDWKVPQGVSKEPGQLEDEEEEPSSFKADSPAEASLASDPHEL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001243625

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM3 (Cervical Cancer proto Oncogene 5, DNA Polymerase alpha holoenzyme Associated P1, DNA Polymerase alpha holoenzyme Associated Protein P1, DNA Polymerase alpha holoenzyme-Associated Protein P1, DNA replication Factor MCM3, DNA Replication Licensing Factor MCM3, HCC 5, HCC5, hRlf beta Subunit, Human cervical Cancer proto Oncogene 5, MCM 3, mcm3, MCM3 minichromosome maintenance deficient 3, MCM3, MGC1157, Minichromosome maintenance Complex Component 3, Minichromosome maintenance) discontinued
224059-01 50 µL

MCM3 (Cervical Cancer proto Oncogene 5, DNA Polymerase alpha holoenzyme Associated P1, DNA Polymerase alpha holoenzyme Associated Protein P1, DNA Polymerase alpha holoenzyme-Associated Protein P1, DNA replication Factor MCM3, DNA Replication Licensing Factor MCM3, HCC 5, HCC5, hRlf beta Subunit, Human cervical Cancer proto Oncogene 5, MCM 3, mcm3, MCM3 minichromosome maintenance deficient 3, MCM3, MGC1157, Minichromosome maintenance Complex Component 3, Minichromosome maintenance) discontinued

Sign In for Pricing
View Details
MCM3 (Cervical Cancer proto Oncogene 5, DNA Polymerase alpha holoenzyme Associated P1, DNA Polymerase alpha holoenzyme Associated Protein P1, DNA Polymerase alpha holoenzyme-Associated Protein P1, DNA replication Factor MCM3, DNA Replication Licensing Factor MCM3, HCC 5, HCC5, hRlf beta Subunit, Human cervical Cancer proto Oncogene 5, MCM 3, mcm3, MCM3 minichromosome maintenance deficient 3, MCM3, MGC1157, Minichromosome maintenance Complex Component 3, Minichromosome maintenance) discontinued
224059-02 100 µL

MCM3 (Cervical Cancer proto Oncogene 5, DNA Polymerase alpha holoenzyme Associated P1, DNA Polymerase alpha holoenzyme Associated Protein P1, DNA Polymerase alpha holoenzyme-Associated Protein P1, DNA replication Factor MCM3, DNA Replication Licensing Factor MCM3, HCC 5, HCC5, hRlf beta Subunit, Human cervical Cancer proto Oncogene 5, MCM 3, mcm3, MCM3 minichromosome maintenance deficient 3, MCM3, MGC1157, Minichromosome maintenance Complex Component 3, Minichromosome maintenance) discontinued

Sign In for Pricing
View Details
Anti-TIMM50 Polyclonal Antibody
TMAB-13550-01 50 μL

Anti-TIMM50 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-TIMM50 Polyclonal Antibody
TMAB-13550-02 100 µL

Anti-TIMM50 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-TIMM50 Polyclonal Antibody
TMAB-13550-03 200 µL

Anti-TIMM50 Polyclonal Antibody

Sign In for Pricing
View Details
EPHA4 Blocking Peptide (Center)
MBS9229540-01 0.5 mg

EPHA4 Blocking Peptide (Center)

Sign In for Pricing
View Details