Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIOBP Rabbit Polyclonal Antibody (Biotin)

TRIOBP Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TARA, TAP68, DFNB28, dJ37E16.4, HRIHFB2122

UniProt

Q9H2D6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRIOBP

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QIHTKDAVYTLSAMTSGIRRNWIEALRKTVRPTSAPDVTKLSDSNKENAL

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_619538

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat IL-10 Biotinylated Affinity Purified PAb
BAF519 50 µg

Rat IL-10 Biotinylated Affinity Purified PAb

Sign In for Pricing
View Details
CD27 (CD27 Antigen, CD27 Molecule, CD27L Receptor, MGC20393, S152, T-cell Activation Antigen CD27, T14, Tp55, Tumor Necrosis Factor Receptor Superfamily Member 7, TNFRSF7) (MaxLight 490) discontinued
C2379-09G-ML490 100 µL

CD27 (CD27 Antigen, CD27 Molecule, CD27L Receptor, MGC20393, S152, T-cell Activation Antigen CD27, T14, Tp55, Tumor Necrosis Factor Receptor Superfamily Member 7, TNFRSF7) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Phospho-CDK5 (Tyr15) Antibody
MBS9601140-01 0.1 mL

Phospho-CDK5 (Tyr15) Antibody

Sign In for Pricing
View Details
Phospho-CDK5 (Tyr15) Antibody
MBS9601140-02 0.2 mL

Phospho-CDK5 (Tyr15) Antibody

Sign In for Pricing
View Details
Phospho-CDK5 (Tyr15) Antibody
MBS9601140-03 5x 0.2 mL

Phospho-CDK5 (Tyr15) Antibody

Sign In for Pricing
View Details
Duck Activated Leukocyte Cell Adhesion Molecule ELISA Kit
MBS054518 Inquire

Duck Activated Leukocyte Cell Adhesion Molecule ELISA Kit

Sign In for Pricing
View Details