Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIOBP Rabbit Polyclonal Antibody (Biotin)

TRIOBP Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TARA, TAP68, DFNB28, dJ37E16.4, HRIHFB2122

UniProt

Q9H2D6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRIOBP

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QIHTKDAVYTLSAMTSGIRRNWIEALRKTVRPTSAPDVTKLSDSNKENAL

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_619538

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kv11.1 Polyclonal Antibody
UB-GEN-15730 100 µL

Kv11.1 Polyclonal Antibody

Sign In for Pricing
View Details
Human four and a half lim domains 1 (HFL1) Elisa Kit
EK711717 96 Well

Human four and a half lim domains 1 (HFL1) Elisa Kit

Sign In for Pricing
View Details
HNF4A (Hepatocyte Nuclear Factor 4-alpha, HNF-4-alpha, Transcription Factor HNF-4, Nuclear Receptor Subfamily 2 Group A Member 1, Transcription Factor 14, HNF4, NR2A1, TCF14) (AP) discontinued
127974-AP 100 µL

HNF4A (Hepatocyte Nuclear Factor 4-alpha, HNF-4-alpha, Transcription Factor HNF-4, Nuclear Receptor Subfamily 2 Group A Member 1, Transcription Factor 14, HNF4, NR2A1, TCF14) (AP) discontinued

Sign In for Pricing
View Details
FPRL1 Polyclonal Antibody Bio Conjugated
C92021Bio 100 µL

FPRL1 Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details
Anti-CCDC52 Antibody
MBS8245248-01 0.03 mL

Anti-CCDC52 Antibody

Sign In for Pricing
View Details
Anti-CCDC52 Antibody
MBS8245248-02 0.05 mL

Anti-CCDC52 Antibody

Sign In for Pricing
View Details