Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTBD3 Rabbit Polyclonal Antibody (HRP)

BTBD3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DJ742J24.1

UniProt

Q9Y2F9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human BTBD3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FLWYTAAKKPELQFVSKARKGLVPQRCHRFQSCAYRSNQWRYRGRCDSIQ

Field of Research

Neuroscience

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055777

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Mvb12b shRNA (UAS) - Lentiviral mouse Mvb12b shRNA (UAS, RFP) plasmid
GTR15250525 1 Vial

Lentiviral mouse Mvb12b shRNA (UAS) - Lentiviral mouse Mvb12b shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Human Sulfotransferase 1A1, SULT1A1 ELISA Kit
MBS928422-01 24 Well (LIMIT 1)

Human Sulfotransferase 1A1, SULT1A1 ELISA Kit

Sign In for Pricing
View Details
Human Sulfotransferase 1A1, SULT1A1 ELISA Kit
MBS928422-02 48 Well

Human Sulfotransferase 1A1, SULT1A1 ELISA Kit

Sign In for Pricing
View Details
Human Sulfotransferase 1A1, SULT1A1 ELISA Kit
MBS928422-03 96 Well

Human Sulfotransferase 1A1, SULT1A1 ELISA Kit

Sign In for Pricing
View Details
Human Sulfotransferase 1A1, SULT1A1 ELISA Kit
MBS928422-04 5x 96 Well

Human Sulfotransferase 1A1, SULT1A1 ELISA Kit

Sign In for Pricing
View Details
Human Sulfotransferase 1A1, SULT1A1 ELISA Kit
MBS928422-05 10x 96 Well

Human Sulfotransferase 1A1, SULT1A1 ELISA Kit

Sign In for Pricing
View Details