Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSIP1 Rabbit Polyclonal Antibody (FITC)

PSIP1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P52, p75, PAIP, DFS70, LEDGF, PSIP2

UniProt

O75475

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PSIP1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DNNPKVKFSSQQAATKQSNASSDVEVEEKETSVSKEDTDHEEKASNEDVT

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_066967

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIGLEC7 3'UTR Lenti-reporter-Luc Vector
43774081 1.0 µg

SIGLEC7 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
SYF2 Antibody (HRP)
orb357022-01 50 µg

SYF2 Antibody (HRP)

Sign In for Pricing
View Details
SYF2 Antibody (HRP)
orb357022-02 100 µg

SYF2 Antibody (HRP)

Sign In for Pricing
View Details
Rat Phospho-AKT (Serine473) (p-AKT Ser473) ELISA Kit
YLA1576RA-01 48 Tests

Rat Phospho-AKT (Serine473) (p-AKT Ser473) ELISA Kit

Sign In for Pricing
View Details
Rat Phospho-AKT (Serine473) (p-AKT Ser473) ELISA Kit
YLA1576RA-02 96 Tests

Rat Phospho-AKT (Serine473) (p-AKT Ser473) ELISA Kit

Sign In for Pricing
View Details
Human Hedgehog Homolog, Desert (DHH) Antibody Pair Kit (with Standard)
MBS2102315-01 5x 96 Tests

Human Hedgehog Homolog, Desert (DHH) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details