Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFX1 Rabbit Polyclonal Antibody (Biotin)

NFX1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NFX2, Tex42, TEG-42

UniProt

Q12986

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NFX1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MAEAPPVSGTFKFNTDAAEFIPQEKKNSGLNCGTQRRLDSNRIGRRNYSS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

113kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_667344

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 10 (BCIE, BIE, EHK, Keratin Type I Cytoskeletal 10, KRT10) (BSA & Azide Free) (MaxLight 750)
MBS6236452-01 0.1 mL

Cytokeratin 10 (BCIE, BIE, EHK, Keratin Type I Cytoskeletal 10, KRT10) (BSA & Azide Free) (MaxLight 750)

Sign In for Pricing
View Details
Cytokeratin 10 (BCIE, BIE, EHK, Keratin Type I Cytoskeletal 10, KRT10) (BSA & Azide Free) (MaxLight 750)
MBS6236452-02 5x 0.1 mL

Cytokeratin 10 (BCIE, BIE, EHK, Keratin Type I Cytoskeletal 10, KRT10) (BSA & Azide Free) (MaxLight 750)

Sign In for Pricing
View Details
mmu-miR-3105-5p miRNA Agomir
MBS8314085-01 5 nmol

mmu-miR-3105-5p miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-3105-5p miRNA Agomir
MBS8314085-02 10 nmol

mmu-miR-3105-5p miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-3105-5p miRNA Agomir
MBS8314085-03 20 nmol

mmu-miR-3105-5p miRNA Agomir

Sign In for Pricing
View Details
mmu-miR-3105-5p miRNA Agomir
MBS8314085-04 5x 20 nmol

mmu-miR-3105-5p miRNA Agomir

Sign In for Pricing
View Details