Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL5 Rabbit Polyclonal Antibody (HRP)

KLHL5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6Y881

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KLHL5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NRGQTGANGGRKFLDPCSLQLPLASIGYRRSSQLDFQNSPSWPMASTSEV

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_950240

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100363731 3'UTR GFP Stable Cell Line
TU258815 1.0 mL

LOC100363731 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
FAM234B Polyclonal Antibody, FITC Conjugated
A62828-050 50 µL

FAM234B Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
C1orf101 (CATSPERE) (NM_173807) Human Tagged Lenti ORF Clone
RC206150L1 10 µg

C1orf101 (CATSPERE) (NM_173807) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Goat anti Human IgM (FITC)
60-S1304GA01-AF 10 ml

Goat anti Human IgM (FITC)

Sign In for Pricing
View Details
Rabbit Polyclonal SLC39A8/ZIP8 Antibody [mFluor Violet 610 SE]
NBP2-97997MFV610 0.1 mL

Rabbit Polyclonal SLC39A8/ZIP8 Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Frozen Tissue Sections, Soft tissue
CS610311 5x 5 µm

Frozen Tissue Sections, Soft tissue

Sign In for Pricing
View Details