Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF558 Rabbit Polyclonal Antibody (HRP)

ZNF558 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ30932

UniProt

Q96NG5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF558

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GILPSTCPDLETLLKAKWLTPKKNVFRKEQSKGVKTERSHRGVKLNECNQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_653294

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SKI (NM_003036) Human Over-expression Lysate
LS006497-100ug 100 µg

SKI (NM_003036) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-Plzf/ZBTB16 Antibody Picoband® (Biotine Conjugate)
PB9969-Biotin 100 µg/Vial

Anti-Plzf/ZBTB16 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
F13B12.1 Antibody
orb800863 2 mg

F13B12.1 Antibody

Sign In for Pricing
View Details
UBAC1, CT (UBAC1, GBDR1, KPC2, UBADC1, Ubiquitin-associated domain-containing protein 1, E3 ubiquitin-protein ligase subunit KPC2, Glialblastoma cell differentiation-related protein 1, Kip1 ubiquitination-promoting complex protein 2) (APC) discontinued
043505-APC 200 µL

UBAC1, CT (UBAC1, GBDR1, KPC2, UBADC1, Ubiquitin-associated domain-containing protein 1, E3 ubiquitin-protein ligase subunit KPC2, Glialblastoma cell differentiation-related protein 1, Kip1 ubiquitination-promoting complex protein 2) (APC) discontinued

Sign In for Pricing
View Details
PE Linked Polyclonal Antibody to Cholinergic Receptor, Muscarinic 3 (CHRM3)
MBS2133993-01 0.1 mL

PE Linked Polyclonal Antibody to Cholinergic Receptor, Muscarinic 3 (CHRM3)

Sign In for Pricing
View Details
PE Linked Polyclonal Antibody to Cholinergic Receptor, Muscarinic 3 (CHRM3)
MBS2133993-02 0.2 mL

PE Linked Polyclonal Antibody to Cholinergic Receptor, Muscarinic 3 (CHRM3)

Sign In for Pricing
View Details