Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clcn5 Rabbit Polyclonal Antibody (HRP)

Clcn5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Clc, ClC-, Clc5, Sfc1, ClC-5, Clc4-, Clcn4, Sfc13, Clc4-1, T25545, Clcn4-1, DXImx42, DXImx42e, 5430408K11Rik, D930009B12Rik

UniProt

Q9WVD4

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057900

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Interleukin 8 (IL8) Mini Samples ELISA Kit
MBS2708237-01 24 Strip Well

Human Interleukin 8 (IL8) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 8 (IL8) Mini Samples ELISA Kit
MBS2708237-02 48 Well

Human Interleukin 8 (IL8) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 8 (IL8) Mini Samples ELISA Kit
MBS2708237-03 96 Well

Human Interleukin 8 (IL8) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 8 (IL8) Mini Samples ELISA Kit
MBS2708237-04 5x 96 Well

Human Interleukin 8 (IL8) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 8 (IL8) Mini Samples ELISA Kit
MBS2708237-05 10x 96 Well

Human Interleukin 8 (IL8) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Human Cluster Of Differentiation 72 (CD72) ELISA Kit
MBS458252-01 48 Tests

Human Cluster Of Differentiation 72 (CD72) ELISA Kit

Sign In for Pricing
View Details