Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcnj3 Rabbit Polyclonal Antibody (Biotin)

Kcnj3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GIR, Kcnf, Kir3, GIRK1, Kcnf3, Kcnj1, GIRK-1, Kir3.1

UniProt

P63250

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDISTKLPSKLQKITGRE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_032452

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Collagen Alpha 1 (XVI) chain (COL16A1) ELISA Kit
GTR10325387 96 Well

Mouse Collagen Alpha 1 (XVI) chain (COL16A1) ELISA Kit

Sign In for Pricing
View Details
Canine Arginyl aminopeptidase like 1 (RNPEPL1) ELISA Kit
GTR10342744 96 Well

Canine Arginyl aminopeptidase like 1 (RNPEPL1) ELISA Kit

Sign In for Pricing
View Details
ZFYVE1 (NM_178441) Human Over-expression Lysate
LC405962 20 µg

ZFYVE1 (NM_178441) Human Over-expression Lysate

Sign In for Pricing
View Details
Gm8994 ORF Vector (Mouse) (pORF)
ORF046246 1.0 µg DNA

Gm8994 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Goat anti-MIA / CD-RAP Antibody
dAP-2774 50 µg

Goat anti-MIA / CD-RAP Antibody

Sign In for Pricing
View Details
Recombinant Pig CTGF protein, N-His Tag
IMP-2738 10 µg

Recombinant Pig CTGF protein, N-His Tag

Sign In for Pricing
View Details