NAD2, Psoroptes ovis (Cell-Free, His)
NAD2 Protein, Psoroptes ovis (Cell-Free, His) is the recombinant NAD2 protein, expressed by E. coli Cell-free, with N-10*His labeled tag.
Product Specifications
Product Name Alternative
NAD2 Protein, Psoroptes ovis (Cell-Free, His), Others, E. coli Cell-free
UNSPSC
12352202
Type
Reference compound
Assay Protocol
https://www.medchemexpress.com/cytokines/nad2-protein-psoroptes-ovis-cf-his.html
Smiles
GMMSKELKKNSMTSSPSMFYLLVQLPASIIFLIFMTSNPNSKTIMCMGILVMMIKSGAFPFHMWYLKTLGLLNMSSPSMKMIMTWQKIIPFFILSYFKLWELLVILGLMNMLIPLVKMSKLSSMKSILVLSSINNNSWFMMSSLLSFMILSLYFMIYSLSLLITMSFLKSVKKKSFILKENPMETMLVIMNLGGIPPSVMFLGKMIIFTLLVKMNLPKEIMMLMLMMACYFMYHYLWCTFPYLMNTPLKSQNQVMNKNTTFMLTLMMLL
Molecular Formula
/ (Gene_ID) A0A075XDS2 (G32-L300) (Accession)
Molecular Weight
32.7 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
More Discoveries
Explore Other Products
Browse additional items from our catalog
LV732196 1.0 µg DNA
LOH1CR1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
Sign In for Pricing
View Details 
MBS6407758-01 0.1 mL
ATP5I (ATP Synthase Subunit E, Mitochondrial,, ATP5K) (MaxLight 490)
Sign In for Pricing
View Details 
MBS6407758-02 5x 0.1 mL
ATP5I (ATP Synthase Subunit E, Mitochondrial,, ATP5K) (MaxLight 490)
Sign In for Pricing
View Details GTR15127251 1 Vial
Lentiviral mouse Vmn1r70 shRNA (UAS) - Lentiviral mouse Vmn1r70 shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details MBS2082404-01 0.1 mL
PE-Linked Polyclonal Antibody to Allura Red AC (ARAC)
Sign In for Pricing
View Details MBS2082404-02 0.2 mL
PE-Linked Polyclonal Antibody to Allura Red AC (ARAC)
Sign In for Pricing
View Details