Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAD2, Psoroptes ovis (Cell-Free, His)

NAD2 Protein, Psoroptes ovis (Cell-Free, His) is the recombinant NAD2 protein, expressed by E. coli Cell-free, with N-10*His labeled tag.

Product Specifications

Product Name Alternative

NAD2 Protein, Psoroptes ovis (Cell-Free, His), Others, E. coli Cell-free

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/nad2-protein-psoroptes-ovis-cf-his.html

Smiles

GMMSKELKKNSMTSSPSMFYLLVQLPASIIFLIFMTSNPNSKTIMCMGILVMMIKSGAFPFHMWYLKTLGLLNMSSPSMKMIMTWQKIIPFFILSYFKLWELLVILGLMNMLIPLVKMSKLSSMKSILVLSSINNNSWFMMSSLLSFMILSLYFMIYSLSLLITMSFLKSVKKKSFILKENPMETMLVIMNLGGIPPSVMFLGKMIIFTLLVKMNLPKEIMMLMLMMACYFMYHYLWCTFPYLMNTPLKSQNQVMNKNTTFMLTLMMLL

Molecular Formula

/ (Gene_ID) A0A075XDS2 (G32-L300) (Accession)

Molecular Weight

32.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (2-Bromoethyl) -2,3-dimethyl-benzene
407493-01 10 mg

1- (2-Bromoethyl) -2,3-dimethyl-benzene

Sign In for Pricing
View Details
1- (2-Bromoethyl) -2,3-dimethyl-benzene
407493-02 25 mg

1- (2-Bromoethyl) -2,3-dimethyl-benzene

Sign In for Pricing
View Details
mmu-miR-3065-3p miRNA Antagomir
MNM01683 2x 5.0 nmol

mmu-miR-3065-3p miRNA Antagomir

Sign In for Pricing
View Details
Ptgr1 Mouse siRNA Oligo Duplex (Locus ID 67103)
SR410994 1 Kit

Ptgr1 Mouse siRNA Oligo Duplex (Locus ID 67103)

Sign In for Pricing
View Details
SLC1A1 discontinued
334479 100 µL

SLC1A1 discontinued

Sign In for Pricing
View Details
2-Mercaptoethanol discontinued
283723 1 Kg

2-Mercaptoethanol discontinued

Sign In for Pricing
View Details