Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAD2, Psoroptes ovis (Cell-Free, His)

NAD2 Protein, Psoroptes ovis (Cell-Free, His) is the recombinant NAD2 protein, expressed by E. coli Cell-free, with N-10*His labeled tag.

Product Specifications

Product Name Alternative

NAD2 Protein, Psoroptes ovis (Cell-Free, His), Others, E. coli Cell-free

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/nad2-protein-psoroptes-ovis-cf-his.html

Smiles

GMMSKELKKNSMTSSPSMFYLLVQLPASIIFLIFMTSNPNSKTIMCMGILVMMIKSGAFPFHMWYLKTLGLLNMSSPSMKMIMTWQKIIPFFILSYFKLWELLVILGLMNMLIPLVKMSKLSSMKSILVLSSINNNSWFMMSSLLSFMILSLYFMIYSLSLLITMSFLKSVKKKSFILKENPMETMLVIMNLGGIPPSVMFLGKMIIFTLLVKMNLPKEIMMLMLMMACYFMYHYLWCTFPYLMNTPLKSQNQVMNKNTTFMLTLMMLL

Molecular Formula

/ (Gene_ID) A0A075XDS2 (G32-L300) (Accession)

Molecular Weight

32.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPCS1 Protein Lysate (Human) with C-Ha Tag
45243031 100 µg

SPCS1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
N-[3- (2,5-Dihydro-5-thioxo-1H-tetrazol-1-yl) phenyl]-N'-methyl-urea
457728-01 100 mg

N-[3- (2,5-Dihydro-5-thioxo-1H-tetrazol-1-yl) phenyl]-N'-methyl-urea

Sign In for Pricing
View Details
N-[3- (2,5-Dihydro-5-thioxo-1H-tetrazol-1-yl) phenyl]-N'-methyl-urea
457728-02 500 mg

N-[3- (2,5-Dihydro-5-thioxo-1H-tetrazol-1-yl) phenyl]-N'-methyl-urea

Sign In for Pricing
View Details
Nptn Rat Pre-designed siRNA Set A
HY-RS26427 1 Set

Nptn Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-MARCH3 antibody
STJ94010 200 µl

Anti-MARCH3 antibody

Sign In for Pricing
View Details
Cavy PDZ and LIM Domain Protein 7 (PDLIM7) ELISA Kit
MBS9939029 Inquire

Cavy PDZ and LIM Domain Protein 7 (PDLIM7) ELISA Kit

Sign In for Pricing
View Details