Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAD2, Psoroptes ovis (Cell-Free, His)

NAD2 Protein, Psoroptes ovis (Cell-Free, His) is the recombinant NAD2 protein, expressed by E. coli Cell-free, with N-10*His labeled tag.

Product Specifications

Product Name Alternative

NAD2 Protein, Psoroptes ovis (Cell-Free, His), Others, E. coli Cell-free

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/nad2-protein-psoroptes-ovis-cf-his.html

Smiles

GMMSKELKKNSMTSSPSMFYLLVQLPASIIFLIFMTSNPNSKTIMCMGILVMMIKSGAFPFHMWYLKTLGLLNMSSPSMKMIMTWQKIIPFFILSYFKLWELLVILGLMNMLIPLVKMSKLSSMKSILVLSSINNNSWFMMSSLLSFMILSLYFMIYSLSLLITMSFLKSVKKKSFILKENPMETMLVIMNLGGIPPSVMFLGKMIIFTLLVKMNLPKEIMMLMLMMACYFMYHYLWCTFPYLMNTPLKSQNQVMNKNTTFMLTLMMLL

Molecular Formula

/ (Gene_ID) A0A075XDS2 (G32-L300) (Accession)

Molecular Weight

32.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCP4 (CCL13) (NM_005408) Human Over-expression Lysate
LS006357-100ug 100 µg

MCP4 (CCL13) (NM_005408) Human Over-expression Lysate

Sign In for Pricing
View Details
AM-4668 5mg
A21778-5 5 mg

AM-4668 5mg

Sign In for Pricing
View Details
NAP1 siRNA (Rat)
MBS8202515-01 15 nmol

NAP1 siRNA (Rat)

Sign In for Pricing
View Details
NAP1 siRNA (Rat)
MBS8202515-02 30 nmol

NAP1 siRNA (Rat)

Sign In for Pricing
View Details
NAP1 siRNA (Rat)
MBS8202515-03 5x 30 nmol

NAP1 siRNA (Rat)

Sign In for Pricing
View Details
Nori® Donkey MUC-14 ELISA Kit
GR170078 96 Well

Nori® Donkey MUC-14 ELISA Kit

Sign In for Pricing
View Details