Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAD2, Psoroptes ovis (Cell-Free, His)

NAD2 Protein, Psoroptes ovis (Cell-Free, His) is the recombinant NAD2 protein, expressed by E. coli Cell-free, with N-10*His labeled tag.

Product Specifications

Product Name Alternative

NAD2 Protein, Psoroptes ovis (Cell-Free, His), Others, E. coli Cell-free

UNSPSC

12352202

Type

Reference compound

Assay Protocol

https://www.medchemexpress.com/cytokines/nad2-protein-psoroptes-ovis-cf-his.html

Smiles

GMMSKELKKNSMTSSPSMFYLLVQLPASIIFLIFMTSNPNSKTIMCMGILVMMIKSGAFPFHMWYLKTLGLLNMSSPSMKMIMTWQKIIPFFILSYFKLWELLVILGLMNMLIPLVKMSKLSSMKSILVLSSINNNSWFMMSSLLSFMILSLYFMIYSLSLLITMSFLKSVKKKSFILKENPMETMLVIMNLGGIPPSVMFLGKMIIFTLLVKMNLPKEIMMLMLMMACYFMYHYLWCTFPYLMNTPLKSQNQVMNKNTTFMLTLMMLL

Molecular Formula

/ (Gene_ID) A0A075XDS2 (G32-L300) (Accession)

Molecular Weight

32.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dansyl-L-asparagine
TRC-D175400-250MG 250 mg

Dansyl-L-asparagine

Sign In for Pricing
View Details
Syt6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
46007114 3x 1.0 µg

Syt6 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Polyclonal antibody-Canine NADH-ubiquinone oxidoreductase chain
PA-RA-07841 100 µg

Polyclonal antibody-Canine NADH-ubiquinone oxidoreductase chain

Sign In for Pricing
View Details
Lrrc36 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3157103 1.0 µg DNA

Lrrc36 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
CDKN3 Protein Vector (Rat) (pPB-N-His)
PV259191 500 ng

CDKN3 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
SCAF4 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV802309 1.0 µg DNA

SCAF4 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details