NAD2, Psoroptes ovis (Cell-Free, His)
NAD2 Protein, Psoroptes ovis (Cell-Free, His) is the recombinant NAD2 protein, expressed by E. coli Cell-free, with N-10*His labeled tag.
Product Specifications
Product Name Alternative
NAD2 Protein, Psoroptes ovis (Cell-Free, His), Others, E. coli Cell-free
UNSPSC
12352202
Type
Reference compound
Assay Protocol
https://www.medchemexpress.com/cytokines/nad2-protein-psoroptes-ovis-cf-his.html
Smiles
GMMSKELKKNSMTSSPSMFYLLVQLPASIIFLIFMTSNPNSKTIMCMGILVMMIKSGAFPFHMWYLKTLGLLNMSSPSMKMIMTWQKIIPFFILSYFKLWELLVILGLMNMLIPLVKMSKLSSMKSILVLSSINNNSWFMMSSLLSFMILSLYFMIYSLSLLITMSFLKSVKKKSFILKENPMETMLVIMNLGGIPPSVMFLGKMIIFTLLVKMNLPKEIMMLMLMMACYFMYHYLWCTFPYLMNTPLKSQNQVMNKNTTFMLTLMMLL
Molecular Formula
/ (Gene_ID) A0A075XDS2 (G32-L300) (Accession)
Molecular Weight
32.7 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS637647-01 0.1 mg
GLC8,1-229aa, Recombinant (Glc8p, Protein GLC8, YM9924.03C, YMR311C)
Sign In for Pricing
View Details MBS637647-02 5x 0.1 mg
GLC8,1-229aa, Recombinant (Glc8p, Protein GLC8, YM9924.03C, YMR311C)
Sign In for Pricing
View Details 
NBP3-26804-100ug 100 µg
Mouse Monoclonal HSP90 alpha Antibody (HSP90AA1/7426)
Sign In for Pricing
View Details 
MBS8805835-01 48 Well
Human TINF2 (TERF1 Interacting Nuclear Factor 2) ELISA Kit
Sign In for Pricing
View Details