NAD2, Psoroptes ovis (Cell-Free, His)
NAD2 Protein, Psoroptes ovis (Cell-Free, His) is the recombinant NAD2 protein, expressed by E. coli Cell-free, with N-10*His labeled tag.
Product Specifications
Product Name Alternative
NAD2 Protein, Psoroptes ovis (Cell-Free, His), Others, E. coli Cell-free
UNSPSC
12352202
Type
Reference compound
Assay Protocol
https://www.medchemexpress.com/cytokines/nad2-protein-psoroptes-ovis-cf-his.html
Smiles
GMMSKELKKNSMTSSPSMFYLLVQLPASIIFLIFMTSNPNSKTIMCMGILVMMIKSGAFPFHMWYLKTLGLLNMSSPSMKMIMTWQKIIPFFILSYFKLWELLVILGLMNMLIPLVKMSKLSSMKSILVLSSINNNSWFMMSSLLSFMILSLYFMIYSLSLLITMSFLKSVKKKSFILKENPMETMLVIMNLGGIPPSVMFLGKMIIFTLLVKMNLPKEIMMLMLMMACYFMYHYLWCTFPYLMNTPLKSQNQVMNKNTTFMLTLMMLL
Molecular Formula
/ (Gene_ID) A0A075XDS2 (G32-L300) (Accession)
Molecular Weight
32.7 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS4502663-01 48 Tests
Mouse Signal Transducer And Activator Of Transcription 1 (STAT1) ELISA Kit
Sign In for Pricing
View Details MBS4502663-02 96 Tests
Mouse Signal Transducer And Activator Of Transcription 1 (STAT1) ELISA Kit
Sign In for Pricing
View Details 
MBS4502663-03 5x 96 Tests
Mouse Signal Transducer And Activator Of Transcription 1 (STAT1) ELISA Kit
Sign In for Pricing
View Details MBS4502663-04 10x 96 Tests
Mouse Signal Transducer And Activator Of Transcription 1 (STAT1) ELISA Kit
Sign In for Pricing
View Details 
BS43443-01 50 µL
Phospho-Synapsin I (Ser553) Recombinant Rabbit mAb
Sign In for Pricing
View Details 
BS43443-02 100 µL
Phospho-Synapsin I (Ser553) Recombinant Rabbit mAb
Sign In for Pricing
View Details