Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCN7A Rabbit Polyclonal Antibody (Biotin)

SCN7A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NaG, SCN6A, Nav2.1, Nav2.2

UniProt

Q01118

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human SCN7A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PFIYGNLSQGMVSEPLEDVDPYYYKKKNTFIVLNKNRTIFRFNAASILCT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_002967.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMBT1 Human Pre-designed siRNA Set A
HY-RS03820 1 Set

DMBT1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
KDM4B Rabbit pAb, AP conjugated
orb2838721 100 µL

KDM4B Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
Anti-Human sFas Ligand Goat Polyclonal Antibody
TA328307 100 µg

Anti-Human sFas Ligand Goat Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Photorhabdus luminescens subsp. laumondii Quaternary ammonium compound-resistance protein sugE (sugE)
orb2922461-01 20 µg

Recombinant Photorhabdus luminescens subsp. laumondii Quaternary ammonium compound-resistance protein sugE (sugE)

Sign In for Pricing
View Details
Recombinant Photorhabdus luminescens subsp. laumondii Quaternary ammonium compound-resistance protein sugE (sugE)
orb2922461-02 100 µg

Recombinant Photorhabdus luminescens subsp. laumondii Quaternary ammonium compound-resistance protein sugE (sugE)

Sign In for Pricing
View Details
Polyclonal Antibody to Adenylate Cyclase 5 (ADCY5)
TRV-0050235-01 20 µL

Polyclonal Antibody to Adenylate Cyclase 5 (ADCY5)

Sign In for Pricing
View Details