Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNAB1 Rabbit Polyclonal Antibody (HRP)

KCNAB1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HKvb3, AKR6A3, KCNA1B, Kvb1.3, hKvBeta3, KV-BETA-1

UniProt

Q14722

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KCNAB1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_751892

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nylon Membrane Filter, Pore:0.22(μm), Diameter: 25(mm)
FBM025NY022 3 x 200 Membrane Filters

Nylon Membrane Filter, Pore:0.22(μm), Diameter: 25(mm)

Sign In for Pricing
View Details
Rabbit Polyclonal SLC45A3/Prostein Antibody
NBP1-89629 0.1 mL

Rabbit Polyclonal SLC45A3/Prostein Antibody

Sign In for Pricing
View Details
F9 (Coagulation Factor IX, Christmas Factor, Plasma Thromboplastin Component, PTC, MGC129641, MGC129642)
139778 200 µL

F9 (Coagulation Factor IX, Christmas Factor, Plasma Thromboplastin Component, PTC, MGC129641, MGC129642)

Sign In for Pricing
View Details
CDK10 (NM_052988) Human Tagged ORF Clone
RG222310 10 µg

CDK10 (NM_052988) Human Tagged ORF Clone

Sign In for Pricing
View Details
Cytochrome P450 2E1 (CYP2E1) (NM_000773) Human Recombinant Protein
E45H36345M5 20 µg

Cytochrome P450 2E1 (CYP2E1) (NM_000773) Human Recombinant Protein

Sign In for Pricing
View Details
Porcine Pentosidine ELISA Kit
YLA0349PO-01 48 Tests

Porcine Pentosidine ELISA Kit

Sign In for Pricing
View Details