Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNA10 Rabbit Polyclonal Antibody (HRP)

KCNA10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Kcn1, Kv1.8

UniProt

Q16322

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human KCNA10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PANVPIDIFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFW

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_005540

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Zebrafish SGCE Antibody Picoband® Fluoro550 Conjugated
AZQ6DHH1-Fluoro550 100 µg/Vial

Anti-Zebrafish SGCE Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
ACTR1A (Alpha-Centractin, ARP1 Actin-Related Protein 1 Homolog A, Centractin Alpha (Yeast) )
474687 100 µL

ACTR1A (Alpha-Centractin, ARP1 Actin-Related Protein 1 Homolog A, Centractin Alpha (Yeast) )

Sign In for Pricing
View Details
CD44 (HCAM, Homing Cell Adhesion Molecule, Pgp-1, Phagocytic Glycoprotein-1, Hermes Antigen, Lymphocyte Homing Receptor, ECM-III, HUTCH-1) (BSA & Azide Free) (PE)
MBS6266876-01 0.1 mL

CD44 (HCAM, Homing Cell Adhesion Molecule, Pgp-1, Phagocytic Glycoprotein-1, Hermes Antigen, Lymphocyte Homing Receptor, ECM-III, HUTCH-1) (BSA & Azide Free) (PE)

Sign In for Pricing
View Details
CD44 (HCAM, Homing Cell Adhesion Molecule, Pgp-1, Phagocytic Glycoprotein-1, Hermes Antigen, Lymphocyte Homing Receptor, ECM-III, HUTCH-1) (BSA & Azide Free) (PE)
MBS6266876-02 5x 0.1 mL

CD44 (HCAM, Homing Cell Adhesion Molecule, Pgp-1, Phagocytic Glycoprotein-1, Hermes Antigen, Lymphocyte Homing Receptor, ECM-III, HUTCH-1) (BSA & Azide Free) (PE)

Sign In for Pricing
View Details
Human Ovostatin homolog 1 ELISA Kit
MBS9428862-01 96 Tests

Human Ovostatin homolog 1 ELISA Kit

Sign In for Pricing
View Details
Human Ovostatin homolog 1 ELISA Kit
MBS9428862-02 5x 96 Tests

Human Ovostatin homolog 1 ELISA Kit

Sign In for Pricing
View Details