Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACNA1I Rabbit Polyclonal Antibody (HRP)

CACNA1I Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Cav3.3, ca (v) 3.3

UniProt

Q9P0X4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CACNA1I

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWAS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

245kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001003406

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BAFF/CD257 Antibody Pair Set
E-KAB-0507 50 µL & 100 µg

Human BAFF/CD257 Antibody Pair Set

Sign In for Pricing
View Details
Human CCL21 Recombinant Rabbit monoclonal Antibody
HA723519 100 µL

Human CCL21 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
MEST (NM_002402) Human Over-expression Lysate
LC419353 20 µg

MEST (NM_002402) Human Over-expression Lysate

Sign In for Pricing
View Details
MDM2 (SMP14), CF647 conjugate, 0.1mg/mL
BNC471721-100 1x 100 µL

MDM2 (SMP14), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NDUFC1 (NM_002494) Human Over-expression Lysate
LC419294 20 µg

NDUFC1 (NM_002494) Human Over-expression Lysate

Sign In for Pricing
View Details
Oxo Lumateperone
TRC-O973110-25MG 25 mg

Oxo Lumateperone

Sign In for Pricing
View Details